תקציר סופי 848-0323-08

 

מחלת הפה והטלפים


נגיף הפה והטלפיים (FMDV) נחשב למסוכן ביותר בין הנגיפים התוקפים חיות משק ולגורם מחלה בעל השפעה כלכלית גדולה. בנוסף על פגיעה בייצור מוצרי חלב ובשר במדינה הנגועה, חל עליה איסור לייצא מוצרים חקלאיים למדינות אחרות מחשש להעברת המחלה. דוגמאות לנזקים שהמחלה גורמת לא חסרות, למשל ההתפרצות שהתרחשה בטייוון ב1997 בה התפשטה המגפה בתוך שבועיים משלוש חוות במחוז אחד לחמש ערים 5734 משקים בחמישה עשר מחוזות שונים וגרמה להשמדתם של שלוש מאות אלף חזירים. דוגמא נוספת היא ההתפרצות האחרונה של המחלה באנגליה. מבחינת תפוצת המחלה אירופה המערבית צפון אמריקה, אוסטרליה וניו-זילנד הם אזורים חופשיים ובהם חל איסור על חיסון. לעומת זאת המחלה אנדמית באפריקה, אסיה ובכלל זה במזרח התיכון ומזרח אירופה והתפרצויות רבות מתרחשות לעיתים קרובות למרות חיסונים חוזרים ונשנים. כמעט כל שנה מדינת ישראל סובלת מהתפרצויות של המחלה, והדוגמא הבולטת של השנים האחרונות היא ההתפרצות שארעה בעגלים שהגיעו מאוסטרליה. בהתפרצות זו פגעה בכ 15,000 ראשי בקר מרמזת עד כמה המחלה יכולה להיות מסוכנת. לאפיון הנגיף הגורם למחלה ישנה חשיבות עליונה בזיהוי מקור הנגיף והתייחסותו לנגיפים שגרמו להתפרצות בעבר. השיטה שבה נעשות הבדיקות הללו במכון היא ע"י השוואות רצף באורך של 237 בסיסים של הגן הנגיפי ל VP1 שהוא החלבון האימונוגני העיקרי של הנגיף. השיטה המקובלת והמדויקת ביותר למעקב ואפיון בידודי נגיף היא על ידי השוואות רצפי הגן השלם ל VP1 שאורכו הוא 639 בסיסים. בתוכנית זו אנו מרחיבים ושפרים את יכולת האפיון של הנגיף ע"י ברור הרצף המלא של הגן ל VP1. לא רק זאת, הרצפים שהתקבלו משמשים לבניית מאגר מידע מקומי שיאחסן את הרצפים של כל הבידודים הישנים והחדשים שיופיעו. בעבודה זו נקבעו התחיליים והתנאים שמאפשרים להגביר את הרצף השלם של הגן ל VP1 בצורה כזו שניתן לבודד את תוצר ההגברה וברור הרצף. עם מציאת התנאים הללו בוררו הרצפים המלאים של הגן ל VP1 הנגיפי מהבידודים מהשנים 1989-2009 המיצגים את הנגיפים שהיו אחראים להתפרצויות בשנים הללו. על סמך מידע זה נעשתה אנליזה של קירבה פילוגנטית עם הרצפים הללו והוברר שכל אחת מהתפרצויות המחלה נובעות מחדירתו של נגיף חדש למדינה או יותר נכון לאזור. עובדה זו נתמכת באנליזות שנעשו בשימוש ברצפי הגן, בנוסף רצפי החלבון המקודד ע"י הגן ל VP1. לא רק זאת, מידע שנצבר בעבודה זו אפשר זיהויי מקור הנגיפים שהיו אחראיים להתפרצויות השונות. בין היתר זוהה שנגיף מנפאל מ 2003 שה

1.2 מבוא ותאור המחלה

מחלת הפה והטלפיים

מחלת הפה והטלפיים היא מחלה מדבקת מאוד (2004 (Grubman and Baxt, הפוגעת בדרך כלל בבעלי חיים בעלי טלפיים. הנזק שלה הוא איבוד מוצרי חלב ובשר. זאת אחת המחלות המזיקות ביותר מבחינה כלכלית לתעשיית הבקר במדינה. מדינת ישראל היא אנדמית למחלה וכמעת כל שנה חלה התפרצות אחת או יותר (Stram, et al., 199).

סימנים קליניים

הסימנים הקליניים של המחלה הם הופעת כיבים באזור ותוך הפה, באזור הטלפיים וכן על העטינים. המחלה מאופיינת בנגיעות גבוהה וכן גורמת לתמותה גבוהה בעגלים צעירים, טליים וגדיים, ירידה בתנובת החלב. רוב ההפסדים נובעים מההסגר מקומי ובין לאומי על תוצרת חקלאית באזורים הנגועים. תקופת הדגירה של המחלה נעה בין יומיים ל 14ימים אך לרוב בין שלושה לארבעה ימים. הזיהום מועבר בדרך כלל בדרכי הנשימה או פצע פתוח.

העברה

הדרך המהירה ביותר להעברת המחלה היא דרך מגע ישיר עם בעלי חיים נגועים. לפני הופעת הסימנים הקליניים הבקר יכול להעביר את הנגיף דרך החלב או דרך הזירמה עד ארבעה ימים. ברגע שהופיעו הסימנים הקליניים יכולת ההדבקה גדלה בשלב הווירלי שהוא בערך 5 ימים שבו כל נוזלי הגוף מכילים את הנגיף העמיד בתנאי הטבע והמסוגל לעבור מרחקים גדולים ברוחות. יכולת ההדבקה של הנגיף מתחזקת כאשר הלחות גבוהה. חזירים מייצרים כמות ויראלית גדולה פי 3000 מאשר בקר כלומר אכילת מוצרים מזוהמים (בדרך כלל מזון לא מעובד) על ידי בעלי חיים יכול לפגוע בהם. אנשים וציוד שקשור לבקר יכולים גם להעביר את הנגיף. העברה בין חיות בר לבין חיות משק שנושאות את הווירוס גם יכולה לגרום להתפרצות המחלה. תקופת הדגירה ויכולת הקליטה של הווירוס תלויים בכמות הווירוס, סוג בעל החיים, דרך הזיהום ורמת החיסון.

בקרת המחלה

בקרת המחלה בארצות אנדמיות מבוססת על השימוש בחיסון בתרכיב המכיל נגיף מומת. בארצות בעלות סיכון גבוה (כגון ישראל) בקר מחוסן פעמיים מדי שנה בשנה בכדי להבטיח הגנה לכל אורך השנה. חיסון מסיבי נגד הנגיף במשך תקופה של שנים יפחית את מספר התפרצויות המחלה. שירות וטרינרי יעיל הינו חיוני לקיום החיסון ולפיקוח על המחלה במקרה של התפרצות. המחלה צריכה להיות תחת שליטה ובהסגר. בגלל השונות האנטיגנית של הנגיפים חשוב להשתמש בחיסון באנטיגן הנכון.

תפוצה גיאוגרפית

יכולת ההתפשטות של הווירוס והיכולת שלו לקבל זהות אנטיגנטית מהווים איום ממשי על הבקר ותוצרת החלב בארצות רבות. אחד האזורים המוכים ביותר הוא המזרח התיכון בו יש התפרצויות מדי שנה אך ישנם גם מאות התפרצויות באסיה, אפריקה, דרום אמריקה, ומזרח אירופה מדי שנה (Stram, et al., 1995).

לעומת זאת צפון ומרכז אמריקה, מערב אירופה, וניו-זילנד נחשבים לאזורים חופשיים מהמחלה ובקר וצאן אינם מחוסנים. בשנת יוצא מהכלל הייתה ההתפרצות של 2001 שפגעה בצורה קשה בבריטניה ובמספר ארצות אחרות במערב אירופה.

 

 

נגיף מחלת הפה והטלפיים

 FMDV משתייך לגנוס Aphthovirus ממשפחת הpicornaviridae. הגנום הוא שרשרת RNA חד גדילית, באורך 8500 בסיסים (Forss, and Schaller, 1982), בעלת אוריינטציה חיובית ופוטנציאל הדבקה ומוקפת קפסיד הבנוי משישים עותקים של כל אחד מארבעת החלבונים המבניים VP1-4 1984). (Grubman et al., 1984; Robertson et al., 1985 and Rueckert and Wimmer,. לחלקיק הנגיפי מראה עגול, חלק, קוטר nm27 בעל סימטרייה איקוסהדראלית [20 פיאות] (תמונה 1) (2003Jackson, et al., ).

 

תמונה 1. מבנה סכמתי של נגיף הפה והטלפיים.

 

תמונה 2 . מבנה סכמתי של גנום נגיף הפה והטלפיים

 

 הקצה ‘3 של הגנום נושא רצף של polyA כאשר הגנום מתפקד כmRNA , הקצה 5’ של RNA הגנומי חסר cap אולם מכיל (Viral genome protein (VPg המקודד ע"י הנגיף והקשור בקשר קוולנטי לקצה זה חלבון מעורב בשכפול ( Grubman, 1980; Sangar et al., 1977),. כ 400 בסיסים מהקצה ה ’5 ישנו רצף poly (c) באורך nt100-200 שהוא חלק מה leader sequence, שלא מתורגם ובנגיף הפה והטלפיים אורכו כ 1200 בסיסים ( Brown et al., 1974)..

הגנום מכיל מסגרת קריאה פתוחה אחת באורך של כ 7000 בסיסים המתורגמת ל polyprotein שנחתך לארבעה תוצרי תרגום ראשוניים L , P1 , P2 , P3, תוצרים אלו נחתכים על ידי שלוש פרוטאזות, המקודדות על ידי הנגיף ,L , 2A , 3C לחלבונים מבניים ולא מבניים בוגרים המתוארים בתמונה 2. הפרוטאזה A2 חותכת את עצמה ולא ידוע על תפקיד נוסף שלה בנגיפי FMDV. הפרוטאזות L ו C3 משמשות גם כגורמים נגיפיים המשתתפים בתהליך ה shut off של התא. הפרוטאזה C3 חותכת גם את ההיסטון H3 ו L את פקטור האנלוגציה eIF4-Gק ( .(Devaney et al., 1988; Medina et al., 1993

תרגום הנגיף מתחיל כולו ברצף המקודד לL protein במנגנון תרגום שלא תלוי ב cap ומכוון על ידי IRES. תוצר התרגום הראשון L הוא proteinase papain like החותך עצמו אוטומטית מה polyprotein החלבון "מכבה" את מערכת התרגום התאית התלויה ב cap על ידי פירוקeIF-4G שהוא אחד הפקטורים המרכיבים את הקומפלקס החלבוני eIF-4F האחראי לגיוס ה cap ולהתחלת תרגום התלוי ב cap, בכך גורמת הפרוטאזה להפסקת הסנתוז של יותר מתשעים אחוז מחלבוני התא המאכסן ומאפשרת לנגיף לנצל את מערכת התרגום התאי לשכפולו המהיר (Devaney et al., 1988; Etchison et al., 1982).

 

שונות אנטיגנית של נגיף הפה והטלפיים

קבוצת נגיפי FMD היא בעלת שונות אנטיגניות רבה ומחולקת לשבעה סרוטיפים שונים – A, O, Asia 1, C, SAT 1-3. בין שבעת הסרוטיפים השונים אין הגנה צולבת המשמעות היא שבעל חיים שחוסן כנגד טיפוס אחד של הנגיף אינו מוגן מפני ששת הזנים האחרים. לכל serotype יש חלוקה פנימית לתת זנים ( Knowles, and Samuel, 2003; Domingo, et al., 2003) הנעשית על בסיס הבדלים כמותיים במבחנים סרולוגיים ומבחנים להגנה צולבת. הגדרת הסירוטיפים מבחינה אימונולוגית מתבססת בעיקר על שינויים בחלבון הקפסיד VP1 שנמצא, על ידי טיפול בטריפסין, כי הוא החלבון האימונוגני העיקרי מבין ארבעת חלבוני VP1-4 המרכיבים את הקפסיד.

 בדיקות רצף שעשו לגנים המקודדים לחלבוני הקפסיד הראו שהשונות הגבוהה ביותר נמצאת באזור המקודד ל ח.א 141-160 של חלבון הקפסיד VP1 (Bachrach, 1977; Barteling et al., 1979; Baxt and Bachrach, 1982; Cavanagh et al. 1977; Moore and Cowan, 1978).

 ארבעה נגיפים שבודדו מדוגמת אפיתל לשון של עגל נגוע בנגיף מסרוטיפ A היו בעלי אותו רצף ח.א בכל אזור חלבוני הקפסיד מלבד שחלופים בעמדות 148 ו 153 של חלבון הקפסיד VP1 כנראה מהעדר לחץ סלקטיבי כנגד שינויים בגנים המבניים ובעיקר ב VP1. לעומת זאת ישנו לחץ סלקטיבי חזק על הגנים הלא מבניים שהם שמורים ביותר בכל קבוצות נגיפי הפה והטלפיים המצביע על חשיבות שמירת הרצף לתהליכי ההתרבות של הנגיף. רצף הבסיסים של אזור P1בגנום (תמונה 2) המקודד לחלבונים המבניים, עובר שינויים רבים ובעיקר באזור הגן ל VP1לעומת האזורים אחרים המקודדים לחלבונים הלא מבניים שהם הרצפים השמורים ביותר בין כל קבוצות נגיפים הזו (Rodrigez, et al., 1992). השינויים התדירים ברצף הגן הם הסיבה לשינויים ברצף חומצות האמינו של הגן וכמובן שונות האנטיגנית האופיינית לנגיף. תופעה זו של מוטציות בתדירות גבוהה בנגיפי RNA בכלל זה MDV מתרחשות, בזמן הכפלת הRNA מאחר ומערכת השעתוק איננה מדויקת (Castro, et al., 2005). תופעה זו היא הבסיס ליכולת הזיהוי והאפיון של הנגיפים הללו, השוואות רצפי הגן של בידודים שונים מאפשרת קביעת קירבה או מרחק של הנגיפים הנבדקים ככל שהרצפים רחוקים יותר כך הנגיפים רחוקים אחד מהשני .ההנחה היא שהנגפים רחוקים יותר מבחינה אבולוציונית. (Stram, et al., 2004 ;Stram, et al., 1995; Knowles and Samuel, 2003)

אנליזה זו היא בעלת חשיבות גדולה לקביעה האם הנגיפים הם אנדמיים באזור נתון, האם הם נגיפים שחדרו לפני ההתפרצות שהם גרמו לה, וכן תאפשר זיהוי מהיר של הנגיף במידה וחלה שבירה של יכולת החיסון כנגד נגיף חדש אשר התרכיב בשימוש איננו יעיל עבר כנגדו. אפיון הנגיף יאפשר הכנה מהירה של תרכיב חדש אשר יאפשר הגנה לעתיד.

דוגמא למסקנות שניתן להגיע בעקבות אנליזות אילו היא ההתפרצות המחלה ב 2006 שהתרחשה בעגלים שהגיעו מאוסטרליה והוכנסו לתחנת ההסגר בצופר שבערבה. בנוסף התפרצות זו הופיעה המחלה באזור חברון. לאחר בירור רצפי הנגיפים שבודדו הן בערבה והן מחברון ועריכת האנליזה הוברר שהנגיפים שהיו אחראים להתפרצויות הללו הם בעלי קירבה גדולה ביותר מקורם כנראה מאותו נגיף. ולא רק זאת, ניתן היה להראות זהות גדולה בינם לבין נגיף הנגיפים שהיו אחראיים להתפרצות ב 2005 מלבנון. אנליזה זו רמזה על קיומו של גורם המשותף התפרצויות ב 2006 ואכן בתחקיר אפדימיולוגי שנערך הוברר שהמשאיות שהעבירו את הבקר האוסטרלי העבירו גם בקר באזור חברון (תמונה 3)

 

 תמונה 3. אנליזת קירבה גנטית. אנליזה של בידודי הנגיף הישראליים כפי שנעשו בתוכנת Pileup בקבוצת התוכנות GCG.

 

 

 

 לאורך כ 12 השנים האחרונות נעשו במכון הווטרינרי בדיקות רצף ואנליזות פילוגנטיות של בידודי שהתקבלו בכל אחת מהתפרצויות המחלה. הבדיקות נעשו בהסתמך על רצף של 237 בסיסים מהגן ל VP1 (Stram, et al., 1995)

 (תמונה 4). בשנים האחרונות כל המרכזים בעולם עברו לבצע אנליזות בהסתמך על הרצף המלא של הגן ל VP1 ולא רק חלק ממנו. אנליזה זו מדויקת יותר מאחר והיא כוללת 639 בסיסים (הגן במלא) בניגוד לרצף חלקי (תמונה 4). לא רק זאת, גודל זה של הרצף מאפשר אנליזה אמינה של על סמך רצף חומצות האמינו של הגן המאפשרת קבלתו של מידע אשר לא ניתן לקבל מאנליזה של חומצות גרעין (Knowles, et al., 2005; Hargreaves, et al., 2004). בהצעה זו אנו מתכננים להכין את הרצף של הגן ל VP1 ממיצגים של כל אחד מאירועי המחלה מתחילת שנות ה 90 ועד עתה, ואם ניתן יהיה את כל הבידודים הקיימים במאגרי המכון. עם התקדמות תהליך בדיקת הרצפים יעשו אנליזות הקרבה הגנטית בתוכנות המתאימות והנמצאות בשימוש במכון הוטרינרי.

 

תמונה 4. תאור הגן ל VP1. הקטע המסומן באדום המשמש עתה לבדיקות רצף ואנליזה של קירבה גנטית.

 

 1.3.1.1.1.1 מטרות המחקר

 מטרות ספציפיות של המחקר

 1. מציאת התחיליים המתאימים להגברת הגן ל VP1 המלא ומציאת התנאים המתאימים לראקצית ההגברה.

 2. הגברה וברור הרצף המלא של הגן ל VP1 מבידודים האחראיים להתפרצות המחלה בשנים האחרונות.

 3. אנליזה של קירבה פילוגנטית בין הבידודים השונים על סמך רצפי חומצות הגרעין וחומצות אמינו.

 

חומרים ושיטות.

הפקת RNA

RNA הופק בשימוש במערכת של Tri Reagent . ה RNA הרחף ב 20 l של H2O ונישמר במקפיא עמוק בטמפרטורה של לפחות -700C. בנוסף, מספר קיטים שונים להפקת RNA שימשו למטרה זו, אחד Viral Gene SpinTM של חברת iNtRON (Sangdaewon-Dong, Joongwon-Gu, Sungnam, Kyungki-Do, 462-120, South Korea). שני, QIAamp viral RNA mini kit של חברת Qiagen. ההפקות נעשו על פי הוראות היצרנים.

RT-PCR

תהליך ה RT-PCR נעשה בשימוש בראקציות של מבחנה אחת ומוכנות של חברת InTron (Sangdaewon-Dong, Joongwon-Gu, Sungnam, Kyungki-Do, 462-120, South Korea) והמכילות את המרכיבים של שני שלבי התהליך (RT ו PCR). בקצרה, למבחנות המכילות את תערובת הריאקציה המיובשת הוספו התחיליים ,(100 g/l each) RNA (1-2 l) ו H2O לנפח סופי של 20 l. תנאי הריאקציה היו 30 sec-1min for 35 cycles. 450C 30 min, 950C 5 min, 940C 40 sec, 45-60OC 30 sec. 72OC . תוצרי הריאקציה נבדקו בג'ל אגרוז עם אתידיום ברומיד.

Nested PCR. התהליך נעשה עם התחיליים 2118 ו 129 כאשר תנאי הראקציה היו 940C למשך 45 שניות 600C ל 30 שניות ו 720C למשך 1 דקה. נעשו 20 מחזורים לקבלה של כמות מספיקה של DNA ללא סימני זיהום והמתאים להפקה ישירה של תוצרי הריאקציה עם הקיט MEGAquick-spinTM של חברת iNtRON על פי הוראות היצרן.

ביואינפורמטיקה

 לעיבוד ממוחשב של תוצאות בדיקות הרצף שימשו מספר תוכנות, EMBOSS, ו Vector NTI. ל Assemble של רצפים שהתקבלו בשימוש בתחיליים השונים שימשו Vector NTI עם תת התוכנה assemble ו DNA Baster (http://www.dnabaser.com) .

לאנליזה פילוגנטית, רצפי הגנים שבוררו עברו השוואה בתוכנת (http://www.ebi.ac.uk/Tools/clustalw2/index.html) ClustalW. תיקיית תוצאת האנליזה, ∗.aln, עברה מודיפיקציה לפורמט של תוכנת MEGA שלאחר ההמרה עברה אנליזה פילוגנטית (Neighbor – Joining, N-J) בתוכנת .MEGA 4 כל אנליזה נעשתה עם 1000 חזרות bootstrap בכדי לבדוק את המובהקות הסטטיסטית של כל אחת מהאנליזות.

כל אחד מהרצפים שבוררו עבר תרגום ממוחשב ב EMBOSS בתת תוכנה Transeq לקבלתו של רצף המשוער של חומצות האמינו של הגנים.

 

תוצאות

השלב הראשון היה כיול מערכת ההגברה שבו נבדקו מספר תחיליים המאפשרים להגביר את הגן בשלומותו כפי שמוצגים בתמונה 5.

 

 תמונה 5. תאור סכמתי של הגן ל VP1 והתחיליים שנבדקו.

 

נבדקו ארבעה זוגות תחיליים והתמונות שיוצגו הם תמונות של אופטימיזצית טמפרטורת ה annealing. הזוג הראשון שניבדק בחלק זה של העבודה היה #2118 TGATGCTGGTAARGACTTTGAGCT הממוקם בבסיס 3200 ו תחל 129TCRACGTCTCTCCYGCCAACT הממוקם בבסיס 3930. הנגיף ששימש לניסיונות הללו היה בידוד ישראלי (להבות הבשן מ 2004)

 

תמונה 6. אנליזה של אופטימיזציה טמפרטורת annealing בשימוש בתחיליים 129 ו 2118. הטמפרטורות מוצגות בתמונה. C-, ביקורת שלילית .

 

 הזוג השני שניבדק היה AATTACACATGGCAARGCYGACGG 2073 הממוקם בבסיס 3152 ו GAAGGGCCCAGGGTTGGACTC 2885.

 

תמונה 7. אנליזה של אופטימיזציה טמפרטורת annealing בשימוש בתחיליים 2073 ו 2885. הטמפרטורות מוצגות בתמונה. C-, ביקורת שלילית .

 

הזוג השלישי שנבדק היה 2118 ו 2885.

 

תמונה 8. אנליזה של אופטימיזציה טמפרטורת annealing בשימוש בתחיליים 2118 ו 2885. הטמפרטורות מוצגות בתמונה. C-, ביקורת שלילית .

 

מהריאקציות שהוצגו נבחר הזוג 2118-2885 מאחר והקטע שעובר הגברה הוא נקי יחסית לאחרים המאפשר ניקוי קל של המקטע ואיננו דורש בידוד לאחר הרצה בג'ל. בכדי להראות שתחיליים 2118-2885 מסוגלים להגביר באופן כללי את הבידודים הישראלים נלקחו 13 בידודים שונים ויכולת המערכת להגביר את הגן נבדקה.

 

תמונה 9. הגברה של הגן ל VP1 מ 13 בידודים שונים עם התחיליים 2118-2885. C- ביקורת שלילית, C+ ביקורת חיובית.

 

נראה שניתן להגביר את הגן מכל הבידודים פרט לאחד, לכן מערכת זו נבחרה להמשך הדרך.

 בכדי לשפר ולהוזיל את יכולות בדיקות הרצפים נעשתה ריאקצית nested PCR כפי שמוצגת בתמונה 10.

 

תמונה 10. סכמת ההגברה של הגן ל VP1.. A.

 סכמה של ההגברה ובדיקת רצף הבסיסים של הגנים ל VP1 הנגיפי. ההגברה הראשונית נעשתה עם התחיליים 2118 ו 2885. כפי שמוצג בתמונה העליונה של B. לאחר מכך נעשתה ראקציה עם התחיליים 2118 ו 129. כפי שמוצג בתמונה התחתונה של B.

B. תמונה עליונה דוגמאות שונות של נגיפים ששימשו לריאקציה עם התחיליים 2118 ו 2885. ערוצים 1-7. ערוץ 8 ביקורת שלילית.

ביקורת שלילית בדיקת הרצף נבדקה עם שני התחיליים משני צידי הגן וכן עם שניים נוספים הפנימיים המוצגים בתמונה 10A כך שהיו מספיק חזרות בבדיקת הרצף.

בצורה זו הריאקציה הראשונה משמשת כמאגר של DNA להגברה לקבלת כמות מספיקה לבדיקת רצף של כל אחד מהגנים. כפי שנאמר למעלה ישנו צורך בכמות גדולה יחסית של DNA משום שנעשו מספר בדיקות רצף לכל אחת מהדוגמאות הנבדקות עם מספר של תחיליים ולפעמים היה צורך לחזור על הבדיקות.

 

בשימוש בתחיליים הללו הוגברו עד עתה הגנים מבידודים מהשנים 1989 עד 2007. הרצפים שהתקבלו היו כפי שמוצגים בתמונות 11 ו 12 .

 

 

>Zarzir-04

ACCACCTCCGCAGGCGAGTCGGCTGACCCCGTAACTGCCCATGTTGAGAACTACGGTGGTGAGACACAGGTTCAGAGACGCCAACACAC GGATGTCTCATTTATACTGGACAGATTTGTGAAAGTGACACCAAAAGACCAAATTAATGTG TTGGATCTGATGCAAACCCC

TGCACACACTTTGGTAGGCGCGCTTCTCCGCACTGCCAC

CTACTACTTCGCAGATTTAGAAGTGGCAGTGAAACACGAGGGGAACCTTACCTGGGTCCCGAA

CGGGGCGCCTGAGACAGCGTTGGACAACACCACCAATCCAACGGCTTACCACAAGGCACCG

CTCACCCGACTCGCGCTGCCTTACACGGCGCCACACCGTGTCTTAGCCACTGTCTACAACGGGA

ACTGCAAGTATGGCGAGAGCTCCGTGACCAACGTGAGAGGTGACCTGCAGGTGTTGGCCCAGAAGGCGGC

AAGGACGCTGCCTACCTCCTTCAATTACGGTGCCATCAAAGCCACTCGGGTGACTGAACTGCTCTACCGCATGAAGAGGGCTG

AGACATACTGCCCCCGGCCTCTTTTGGCCATTCACCCGAGCGAAGCTAGACACAAACAAAAGATTGTGGCGC

>Kfar Manda-04

accacct

ccgcaggcgagtcggctgaccccgtaactgcCACtgttgagaactacggtggtgagacac

aggttcagagacgccaacacacggatgtctcatttatactggacagatttgtgaaagtga

caccaaaagaccaaattaatgtgttggatctgatgcaaacccctgcacacactttggtag

gcgcgcttctccgcactgccacctactacttcgcagatttagaagtggcagtgaaacacg

aggggaaccttacctgggtcccgaacggggcgcctgagacagcgttggacaacaccacca

atccaacggcttaccacaaggcaccgctcacccgactcgcgctgccttacacggcgccac

accgtgtcttagccactgtctacaacgggaactgcaagtatggcgagagctccgtgacca

acgtgagaggtgacctgcaggtgttggcccagaaggcggcaaggacgctgcctacctcct

tcaattacggtgccatcaaagccactcgggtgactgaactgctctaccgcatgaagaggg

ctgagacatactgcccccggcctcttttggccattcacccgagcgaagctagacacaaac

aaaagattgtggcgcctgtgaaacaactcttg

>Ber-Sheva-07 22032

ACCACCT

CCACAGGTGAGTCAGCTGACCCCGTGACTACCACTGTTGAGAACTACGGTGGCGAGACAC

AGGTCCAGAGACGCCAGCACACGGATGTCTCGTTCATATTGGACAGATTTGTGAAAGTGA

CACCAAAAGACCAAATTAATGTGTTGGACTTGATGCAAACCCCCGCCCACACGTTGGTAG

GCGCGCTCCTCCGCACCGCCACCTACTACTTCGCAGATCTAGAGGTGGCAGTGAAACATG

AGGGGAACCTTACCTGGGTCCCGAATGGGGCGCCCGAGACAGCGTTGGATAACACCACTA

ACCCAACGGCTTACCACAAAGCACCGCTCACCCGACTTGCACTGCCTTACACGGCACCAC

ACCGTGTCTTGGCTACCGTATACAACGGGAACTGCAAGTATGGCGAGAGCCACACAACCA

ACGTGAGAGGTGACCTGCAAGTGTTGGCCCAGAAGGCGGCGATAACGCTGCCTACTTCCT

TTAACTACGGTGCCATCAAAGCTACCCGGGTGACTGAATTGCTTTACCGCATGAAGAGGGC

TGAAACATACTGCCCCCGGCCTCTTTTGGCCATTCACCCGAACGAAGCAAGACACAAACAAA

AGATAGTGGCACCTGTGAAGCAGCTTTTG

>Eilot-07 22033

ACCACCTCCACAGGTGAGTCAGCTGACCCCGTGACTGCCACTGTTGAGAACTACGGTGGCGAG

ACACAGGTCCAGAGACGCC AGCACACGGATGTCTCGTTCATATTGGACAGATTTGTGAAAGTGACACCAAAAGACCAAATTA ATGTGTTGGACTTGATGCAAACCCCCGCCCACACTTTGGTAGGCGCGCTCCTCCGCACCGCC

ACCTACTACTTCGCAGATCTAGAGGTGGCGGTGAAACATGAGGGGAACCTTACCTGGGTCCC

GAATGGGGCGCCCGAGACAGCGTTGGATAACACCACTAATCCAACGGCTTACCACAAAGCGC

CGCTCACCCGACTTGCACTGCCTTACACGGCACCACACCGTGTCTTGGCTACCGTATACAAC

GGGAACTGCAAGTATGGCGAGAGTCACACAACTAACGTGAGAGGTGACCTGCAAGTGTTGGC

CCAGAAGGCGGCGATAACGCTGCCTACCTCCTTCAACTACGGTGCCATCAAAGCTACCCGGG

TGACTGAATTGCTTTACCGTATGAAGAGGGCTNAAACATACTGCCCCCGGCCTCTTTTGG

CCATTCACCCGAACGAAGCAAGACACAAACAAAAGATAGTGGCACCTGTGAAGCAGCTCTTG

>Bet-Sharim-07 22034

ACCACCTCCACAGGTGAGTCAGCTGACCCCGTGACTACCACTGTTGAGAACTACGGTGGCGAGACACAGGTCCAGAGA

CGCCAGCACACGGATGTCTCGTTCATATTGGACAGATTTGTGAAAGTGACACCAAAAGACCA

AATTAATGTGTTGGACTTGATGCAAACCCCCGCCCACACGTTGGTAGGCGCGCTCCTCCGCAC

CGCCACCTACTACTTCGCAGATCTAGAGGTGGCAGTGAAACATGAGGGGAACCTTACCTGGG

TCCCGAATGGGGCGCCCGAGATAGCGTTGGACAACACCACTAACCCAACGGCTTACCACAAA

GCACCGCTCACCCGACTTGCACTGCCTTACACGGCACCACACCGTGTCTTGGCTACCGTATAC

AACGGGAACTGCAAGTATGGCGAGAGCCACACAACCAACGTGAGAGGTGACCTGCAAGTGTT

GGCCCAGAAGGCGGCGATAACGCTGCCTACCTCCTTTAACTACGGTGCCATCAAAGCTACCC

GGGTGACTGAATTGCTTTACCGCATGAAGAGGGCTGAAACATACTGCCCCCGGCCTCTTTTG

GCCATTCACCCGAACGAAGCAAGACACAAACAAAAGATAGTGGCACCTGTGAAGCAGCTTTTG

>Ramala-02 25034

ACCACCTCCACAGGTGAGTCTGCTGATCCCGTGACCGCCACTGTTGAGAACTACGGTGGGGAGACACAGGTCCGGAGACGTCG

ACACACTGACGTTTCGTTTATTTTGGACAGATTTGTGAAAGTGACACCAAAAGACCAAGTTA

ATGTGTTAGACCTGATGCAAACTCCTGCCCACACTTTGGTGGGCGCACTCCTCCGTGCTGCT

ACTTACTACTTTGCAGACTTAGAAGTGGCAGTGAAACACGAGGGGAACCTCACCTGGGTCCC

GAACGGGGCGCCCGAGAAAGCGTTGGAAAACACCACCAATCCAACAGCTTATCACAAGGCAC

CGCTCACCCGACTTGCGCTGCCTTACACAGCACCACACCGTGTTTTGGCTACTGTTTACAA

CGGGAACTGCAAGTATGGCGAGGGCGCTGTGACCAACGTGAGGGGTGACCTGCAAGTGTTG

GCCCAGAAGGCGGCGAGAACGCTGCCCACCTCCTTCAACTACGGTGCCATCAAGGCTACTCG

GGTGACCGAGCTGCTTTACCGCATGAAGAGGGCCGAAACATACTGCCCTCGGCCCCTTTTGG

CCATTCACCCGAGCGAAGCCAGACACAAACAAAAGATTGTGGCACCCGTGAAACAGCTTTTG

>Ramala2-02 25035

ACCACCTCCACAGGTGAGTCTGCTGATCCCGTGACCGCCACTGTTGAGAACTACGGTGGGGAGACACAGGTCCGGAGACGTC

GACACACTGACGTTTCGTTTATTTTGGACAGATTTGTGAAAGTGACACCAAAAGACCAAGTT

AATGTGTTAGACCTGATGCAAACCCCTGCCCACACTTTGGTGGGCGCACTCCTCCGTGCTGC

TACTTACTACTTCGCAGACTTAGAAGTGGCAGTGAAACACGAGGGGAACCTCACCTGGGTCCC

GAACGGGGCGCCCGAGAAAGCGTTGGAAAACACCACCAATCCAACGGCTTATCACAAGGCA

CCGCTCACCCGACTTGCGCTGCCTTACACAGCACCACACCGTGTTTTGGCTACTGTTTACAAC

GGGAACTGCAAGTATGGCGAGGGCGCTGTGACCAACGTGAGGGGTGACCTGCAAGTGTTGG

CCCAGAAGGCGGCGAGAACGCTGCCCACCTCCTTCAACTACGGTGCCATCAAGGCTACCCGGG

TGACCGAGCTGCTTTACCGCATGAAGAGGGCCGAAACATACTGCCCTCGGCCCCTTTTGGC

CATTCACCCGAGCGAAGCCAGACACAAACAAAAGATTGTGGCCCCCGTGAAACAGCTTTTG

>Tzofar-06 25036

ACCACCTCTGCAGGCGAGTCAGCTGACCCCGTGACTGCCACTGTTGAGAACTACGGTGGTGAGACACAGGTCCAGAGA

CGCCAACACACGGATGTCTCATTTATATTGGACAGATTTGTGAAAGTGACACCAAAAGACC

AAATTAATGTGTTGGACCTGATGCAAACCCCTGCACACACTTTGGTAGGCGCGCTCCTCCGCAC

TGCCACCTACTACTTCGCAGATTTAGAAGTGGCAGTGAAACACGAGGGGAACCTTACCTGGG

TCCCGAATGGGGCGCCTGAGACAGCGTTGGATAACACCACCAATCCAACGGCCTACCACAAG

GCACCTCTCACCCGGCTCGCGCTGCCTTACACGGCACCACACCGTGTCTTGGCCACTGTCTA

CAATGGGAACTGCAAGTACGGCGAGAGCCCGGTGACCAACGTGAGAGGTGACCTACAAGTGTT

GGCCCAGAAGGCGGCAAGGACGCTGCCTACCTCCTTCAATTACGGTGCCATCAAAGCTACTC

GGGTGACTGAACTGCTTTATCGCATGAAGAGGGCTGAGACATACTGCCCCCGGCCCCTTTT

GGCCATTCACCCGAGCGAGGCTAGACACAAACAAAAGATTGTGGCACCTGTGAAACAACTCTTG

>Ein Hashofet-04

ACCACCTCCGCAGGCGAGTCGGCTGACCCCGTAACTGCCNCTGTTGAGAACTACGGTGGTGAGACA

CAGGTTCAGAGACGCCAACACACGGATGTCTCATTTATACTGGACAGATTTGTGAAAGTGAC

ACCAAAAGACCAAATTAATGTGTTGGATCTGATGCAAACCCCTGCACACACTTTGGTAGGCG

CGCTTCTCCGCACTGCCACCTACTACTTCGCAGATTTAGAAGTGGCAGTGAAACACGAGGGG

AACCTTACCTGGGTCCCGAACGGGGCGCCTGAGACAGCGTTGGACAACACCACCAATCCAAC

GGCTTACCACAAGGCACCGCTCACCCGACTCGCGCTGCCTTACACGGCGCCACACCGTGTC

TTAGCCACTGTCTACAACGGGAACTGCAAGTATGGCGAGAGCTCCGTGACCAACGTGAGAGGT

GACCTGCAGGTGTTGGCCCAGAAGACGGCAAGGACGCTGCCTACCTCCTTCAATTACGGTG

CCATCAAAGCCACTCGGGTGACTGAACTGCTCTACCGCATGAAGAGGGCTGAGACATACTGC

CCCCGGCCTCTTTTGGCCATTCACCCGAGCGAAGCTAGACACAAACAAAAGATTGTGGCGC

>Zvaidat-04 25038

ACCACCTCCGCAGGCGAGTCGGCTGACCCCGTAACTGCCACTGTTGAGAACTACGGTGGTGAGACACAGGTTCAGAG

ACGCCAACACACGGATGTCTCATTTATACTGGACAGATTTGTGAAAGTGACACCAAAAGACC

AAATTAATGTGTTGGATCTGATGCAAACCCCTGCACACACTTTGGTAGGCGCGCTTCTCCGCA

CTGCCACCTACTACTTCGCAGATTTAGAAGTGGCAGTGAAACACGAGGGGAACCTTACCTGGG

TCCCGAACGGGGCGCCTGAGACAGCGTTGGACAACACCACCAATCCAACGGCTTACCACAA

GGCACCGCTCACCCGACTCGCGCTGCCTTACACGGCGCCACACCGTGTCTTAGCCACTGTCTAC

AACGGGAACTGCAAGTATGGCGAGAGCTCCGTGACCAACGTGAGAGGTGACCTGCAGGTGTT

GGCCCAGAAGGCGGCAAGGACGCTGCCTACCTCCTTCAATTACGGTGCCATCAAAGCCACTC

GGGTGACTGAACTGCTCTACCGCATGAAGAGGGCTGAGACATACTGCCCCCGGCCTCTTTTG

GCCATTCACCCGAGCGAAGCTAGACACAAACAAAAGATTGTGGCGCCTGTGAAACAACTCTTG

>El-Rom-04 25039

ACCACCTCCGCAGGCGAGTCGGCTGACCCCGTAACTGCCACTGTTGAGAACTACGGTGGTGAGA

CACAGGTTCAGAGACGCCAACACACGGATGTCTCATTTATACTGGACAGATTTGTGAAAGTGA

CACCAAAAGACCAAATTAATGTGTTGGATCTGATGCAAACCCCTGCACACACTTTGGTAGG

CGCGCTTCTCCGCACTGCCACCTACTACTTCGCAGATTTAGAAGTGGCAGTGAAACACGAGGG

GAACCTTACCTGGGTCCCGAACGGGGCGCCTGAGACAGCGTTGGACAACACCACCAATCCAA

CGGCTTACCACAAGGCACCGCTCACCCGACTCGCGCTGCCTTACACGGCGCCACACCGTGTC

TTAGCCACTGTCTACAACGGGAACTGCAAGTATGGCGAGAGCTCCGTGACCAACGTGAGAGG

TGACCTGCAGGTGTTGGCCCAGAAGGCGGCAAGGACGCTGCCTACCTCCTTCAATTACGGTG

CCATCAAAGCCACTCGGGTGACTGAACTGCTCTACCGCATGAAGAGGGCTGAGACATNCTGC

CCCCGGCCTCTTTTGGCCATTCACCCGAGCGAAGCTAGGCACAAACAAAAGATTGTGGCGC

>367597

accacctccacagg

tgagtctgccgatcccgtgaccaccactgttgagaactacggtggggagacacaggtccggagacgtcga

cacactgacgtttcgtttattttggacagatttgtgaaagtgacaccaaaagaccaagttaatgtgttag

acctgatgcaaactcctgcccacactttggtgggcgcactcctccgtgctgctacttactactttgcaga

cttagaagtggcagtgaaacacgaggggaacctcacctgggtcccgaacggggcgcccgagaaagcgttg

gaaaacaccaccaatccaacagcttatcacaaggcaccgctcacccgacttgcgctgccttacacagcac

cacaccgtgttttggctactgtttacaacgggaactgcaagtatggcgagggcgctgtgaccaacgtgag

gggtgacctgcaagtgttggcccagaaggcggcgagaacgctgcccacctccttcaactacggtgccatc

aaggctactcgggtgaccgagctgctttaccgcatgaagagggccgaaacatactgccctcggccccttc

tggccattcacccgagcgaagccagacacaaacaaaagattgtggcacccgtgaaacagcttttg

>Neve Ur-07

accacctccacaggcga

gtcagctgaccccgtgactgccactgttgagaactacggtggcgagacacaggtccagagacgccagcac

acggatgtctcgttcatattggacagatttgtgaaagtgacaccaaaagaccaaattaatgtgttggact

tgatgcaaacccccgcccacactttggtaggcgcgctcctccgcaccgccacctactacttcgcagatct

agaggtggcagtgaaacataaggggaaccttacctgggtcccgaatggggcgcccgagacagcgttggat

aacaccactaatccaacggcttaccacaaagcaccgctcacccgacttgcactgccttacacggcaccac

accgtgtcttggctaccgtatacaacgggaactgcaagtatggcgagagccacacaaccaacgcgagagg

tgacctgcaggtgttggcccagaaggcggcgataacgctgcctacctcctttaactacggtgccatcaaa

gctacctgggtgactgaattgctttaccgcatgaagagggctgaaacatactgcccccggcctcttttgg

ccattcacccgaacgaagcaagacacaaacaaaagatagtggcacctgtgaaacagctcttg

>Aborgieb-99

accacctccacaggtgagtcggctgaccccgtgactgccactgttgagaactacggtggtgagacgcaggtccaga

ggcgccaacacacggatgtctcgttcatattggacagatttgtgaaagtaacaccaaaagaccaaattaa

tgtgttggacctgatgcaaacccctgcacacactttggtaggcgcgctcctccgtactgccacctactac

ttcgcagatctagaagtggcagtgaaacacgaggggaaccttacctgggtcccgaatggggcgcccgaga

cagcgttggacaacaccaccaacccaacggcttaccacaaggcaccgctcacccggcttgcactacctta

cacggcaccacaccgtgtcttggctactgtttacaacgggaactgcaagtatggcgagggccccgtgacc

aatgtgagaggtgacctgcaagtgttggcccagaaggcggcaagaacgctgcctacctccttcaactacg

gtgccatcaaagccacccgggtgactgaactgctttaccgcatgaagagggccgaaacatactgcccccg

gcctcttttggctattcacccgagcgaagctagacacaaacaaaagattgtggcacctgtgaaac

<Lehavot-Habashan-04 fmdv7

accacctctgcgggcgaatcggctaaccccgtgattgccactgttgagaactacggcggt

gagacacaagttcaaaggcgtcaacacacggacgtctcgtttatattggacagatttgtg

aaagtgacaccaaaagaccaaattaatgtactggacttgatgcagacccccgcccacact

ctggtgggcgcgctcctccgcgctgccacttactactttgctgacttggaggttgcagtt

aaacacgagggaaacctcacctgggtcccgaacggggcgcctgagaaggcgttggacaac

accaccaacccaacagcttaccacaaggcaccgctcacccggcttgcgctgccttacacg

gcgccgcaccgtgtgttggctactgtttacaacgggaactgcaggtacggtgaaggccct

gtgaccgctgtgagaggtgacctacaagtgttggcccagaaggcggctagaacgctgccc

acctccttcaactacggcgccatcaaggctacacgggtgactgaactgctttaccgcatg

aagagggctgagacatactgcccccggcctcttttggccattcacccggacgaagccaga

cacaagcaaaagatcgtggcacctgtgaagcagcttcta

>South-Lebanon-94 fmdv8

accacctctgcgggt

gaatcggctaaccctgtgactgccactgttgagaactatggcggtgagacacaagttcaaaggcgtcaac

acacggacgtctcgtttatattggacagatttgtgaaagtgacaccaaaagaccaaattaatgtactgga

cttgatgcagacccccgcccacactctggtgggcgcgctcctccgcgctgccacttactactttgctgac

ttggaggttgcagttaaacacgagggaaacctcacctgggtcccgaacggggcgcctgagaaggcgttgg

acaacaccaccaacccaacagcttaccacaaggcaccgctcacccggcttgcgctgccttacacggcgcc

gcaccgtgtgttggctactgtttacaacgggaactgcaggtacggtgaaggccccgtgaccgctgtgaga

ggtgacctacaagtgttggcccagaaggcggctagaacgctgcccacctccttcaactacggcgccatca

aggctacacgggtgactgaactgctttaccgcatgaagagggctgagacatactgcccccggcctctttt

ggccattcacccgaacgaagccagacacaagcaaaagatcgtggcacctgtgaagcagcttcta

>Sasa-04 fmdv9

accacctctgcggg

tgaatcggctaaccctgtgactgccactgttgagaactatggcggtgagacacaagttcaaaggcgtcaa

cacacggacgtctcgtttatattggacagatttgtgaaagtgacaccaaaagaccaaattaatgtactgg

acttgatgcagacccccgcccacactctggtgggcgcgctcctccgcgctgccacttactactttgctga

cttggaggttgcagttaaacacgagggaaacctcacctgggtcccgaacggggcgcctgagaaggcgttg

gacaacaccaccaacccaacagcttaccacaaggcaccgctcacccggcttgcgctgccttacacggcgc

cgcaccgtgtgttggctactgtttacaacgggaactgcaggtacggtgagggccctgtgaccgctgtgag

aggtgacctacaagtgttggcccagaaggcggctagaacgctgcccacctccttcaactacggcgccatc

aaggctacacgggtgactgaactgctttaccgcatgaagagggctgagacatactgcccccggcctcttt

tggccattcacccgaacgaagccagacacaagcaaaagatcgtggcacctgtgaagcagcttcta

>Jerico-04 fmdv10

accacctctgcgggtgaa

tcggctgaccctgtgactgccactgtcgagaactacggcggtgagacacaagtccaaaggcgtcaacaca

cggacgtctcgttcatactggacagatttgtgaaagtgacaccaaaagaccaaatcaatgtattggactt

gatgcaaacccctgcccacactctggtgggtgcgctccttcgcgccgccacttactactttgctgatctg

gaggttgcagtcaaacacgagggaaacctcacctgggtcccgaacggggcgcctgagaaggcgttggaca

ataccaccaacccaacagcataccacaaggcaccgctcacccggcttgcactgccctacacggcaccaca

ccgtgtattggctactgtttacaacgggaactgtaggtacggtgaaagctctgtgaccgccgtaagaggt

gacctacaagtgttggcccggaaggcggcgacaacgctgcccacctccttcaactacggtgctatcaagg

ctacacgggtgactgaactgctttaccgcatgaagagggctgagacatactgcccccggccccttttggc

cattcacccaaacgaagccagacacaaacaaaagattgtggcacctgtgaagcagctttta

>Melea-94 fmdv11

accacctctgcgggngaatcggctgaccctgtgactgccactgtcgagaactacggcggt

gagacacaagtccaaaggcgtcaacacacggacgtctcgttcatactggacagatttgtg

aaagtgacaccaaaagaccaaatcaacgtattggacttgatgcaaacccctgcccacact

ctggtgggtgcgctccttcgcgccgccacttactactttgctgatctggaggttgcagtc

aaacacgagggaaacctcacctgggtcccgaacggggcgcctgagaaggcgttggacaac

accaccaacccaacagcataccacaaggcaccgctcacccggcttgcactgccttacacg

gcaccacaccgtgtattggctactgcttacaacgggaactgcaggtacggtgaaagctct

gtgaccgccgtaagaggtgacctacaagtgttggcccggaaggcggcgacaacgctgccc

acctccttcaactacggtgctatcaaggctacacgggtgactgaactgctttaccgcatg

aagagggctgagacatactgcccccggccccttttggccattcacccaaacgaagccaga

cacaaacaaaagattgtggcacctgtgaagcagctttta

>Taybee-94 fmdv12

accacctctgcgggtgaa

tcggctgaccctgtgactgccactgtcgagaactacggcggcgagacacaagtccaaaggcgtcaacaca

cggacgtctcgttcatactggacagatttgtgaaagtgacaccaaaagaccaaatcaatgtattggactt

gatgcaaacccctgcccacactctggtgggtgcgctccttcgcgccaccacttactactttgctgatctg

gaggttgcagtcaaacacgagggaaacctcacctgggtcccgaacggggcgcctgagaaggcgttggaca

acaccaccaacccaacagcgtaccacaaggcaccgctcacccggcttgcactgccttacacggcaccaca

ccgtgtattggctactgtttacaacgggaactgcaggtacggtgaaagctctgtgaccgccgtaagaggt

gacctacaagtgttggcccggaaggcggcgacaacgctgcccacctccttcaactacggtgctatcaagg

ctacacgggtgactgaactgctttaccgcatgaagagggctgagacatactgcccccggccccttttggc

cattcacccaaacgaagccagacacaaacaaaagattgtggcacctgtgaagcagctttta

>Gush-Halav-96 gus96Contig

ACCACCTCCA

CAGGTGAGTCGGCTGATCCCGTGACCGCCACTGTTGAGAACTACGGTGGCGAGACACAGGTCCAGAGACG

CCAACACACGGACGTCTCGTTCATATTGGACAGATTTGTGAAAGTAACACCCAAAGACCCAATTACTGTG

TTGGACCTGATGCAAACCCCTGCCCACACTTTGGTGGGTGCGCTCCTCCGTACTGCTACTTACTACTTTG

CAGACCTAGAAGTGGCAGTAAAACACGAGGGGAACCTCACCTGGGTCCCGAATGGGGCGCCCGAGACAGC

GTTGGACAACACCACCAATCCAACGGCTTACCACAAGGCACCGCTCACCCGTCTCGCACTGCCTTACACG

GCACCACACCGCGTGTTGGCTACTGTGTACAACGGGAACTGCAAGTACGGCGAGAGCTCGGTGACCAATG

TGAGAGGTGACCTGCAAGTGTTGGTCCAGAAGGCGGCAAGAACGCTGCCCACCTCCTTCAACTACGGTGC

CATTAAGGCCACCCGGGTGACTGAACTGCTTTACCGCATGAAGAGGGCCGAAACATACTGCCCCCGGCCT

CTTTTGGCCATTCATCCGGGTGAAGCCAGACACAAACAAAAGATTGTGGCCCCTGTGACAGAGCTTCTG

>Jordan-99 2293-rev

accacctccacaggtgagtcgg

ctgaccccgtgactgccactgttgagaactacggtggtgagacgcaggtccagagacgcc

aacacacggatgtctcgttcatattggacagatttgtgaaagtaacaccaaaagaccaaa

ttaatgtgttggacctgatgcaaactcctgcacacactttggtaggcgcgctcctccgta

ctgccacctactacttcgcagatctagaagtggcagtgaaacacgaggggaaccttacct

gggtcccgaatggggcgcccgagacagcgttggacaacaccaccaatccaacggcttacc

acaaggcaccgctcacccggcttgcactgccttacacggcaccacaccgtgttttggcta

ctgtttacaacgggaactgcaagtatggcgagagccctgtgaccaatgtgagaggtgacc

tgcaagtgttggcccagaaggcggcaggaacgctgcctacctccttcaactacggtgcca

tcaaagccacccgggtgactgaactgctttaccgtatgaagagggccgaaacatactgcc

cccggcctcttttggctatccacccgagcgaagctagacacaaacaaaagattgtggcac

ccgtgaaacagctcttg

>Jorden-tafila-99

accacctccacaggtgagtcggctgaccccgtgactgccactgttg

agaactacggtggtgagacgcaggtccagaggcgccaacacacggatgtctcgttcatattggacagatt

tgtgaaagtaacaccaaaagaccaaattaatgtgttggacctgatgcaaacccctgcacacactttggta

ggcgcgctcctccgtaccgccacctactacttcgcagatctagaagtggcagtgaaacacgaggggaacc

ttacctgggtcccgaatggggcgcccgagacagcgttggacaacaccaccaacccaacggcttaccacaa

ggcaccgctcacccggcttgcactaccttacacggcaccacaccgtgtcttggctactgtttacaacggg

aactgcaagtatggcgagggccccgtgaccaatgtgagaggtgacctgcaagtgttggcccagaaggcgg

caagaacgctgcctacctccttcaactacggtgccatcaaagccacccgggtgactgaactgctttaccg

catgaagagggccgaaacatactgcccccggcctcttttggctattcacccgagcgaagctagacacaaa

caaaagattgtggcacctgtgaaacagctcttg

<Kalkilia-99

accacaggtgagtcggctgaccccgtgactgccactgttgagaact

acggtggtgagacgcaggtccagaggcgccaacacacggatgtctcgttcatattggacagatttgtgaa

agtaacaccaaaagaccaaattaatgtgttggacctgatgcaaacccctgcacacactttggtaggcgcg

ctcctccgtactgccacctactacttcgcagatctagaagtggcagtgaaacacgaggggaaccttacct

gggtcccgaatggggcgcccgagacagcgttggacaacaccaccaacccaacggcttaccacaaggcacc

gctcacccggcttgcactaccttacacggcaccacaccgtgtcttggctactgtttacaacgggaactgc

aagtatggcgagggccccgtgaccaatgtgagaggtgacctgcaagtgttggcccagaaggcggcaagaa

cgctgcctacctccttcaactacggtgccatcaaagccacccgggtgactgaactgctttaccgcatgaa

gagggccgaaacatattgcccccggcctcttttggctattcacccgagcgaagctagacacaaacaaaag

attgtggcac

<Kfarmusala1-89

accacttc

cacgggtgagtcggctgaccccgtgaccgccactgttgaacactacggcggtgaaacacaggtccagagg

cgccagcacacagacgtctcgttcatattggacagatttgtgaaaataacaccaaaagaccaaattaacg

tgttggacctgatgcaaacccctgcccacaccttggtgggcgcgctccttcgtactgctacctactactt

cgcggatttagaagtggcagtgaaacacgaggggaacctcacttgggtcccgaacggagcgcctgaggca

gcgttggataacaccaccaacccaacagcttatcacaaggcaccgctcacccgacttgcactgccttaca

cggcaccacaccgtgtgttggctactgtttacaacggaaattgcaggtatggtgagagctctgtgactaa

tgtgaggggtgacctacaagtgttggcccagaaggcggcgagaacgctgcctacctccttcaattacggt

gctatcaaggccactcgggtgactgaactgctttaccgcatgaagagggctgaaacatactgcccacggc

ctctcttggccatccacccgaacgaagccagacacaaacaaaagattgtggcacctgtgaaacaacttct

g

<Kfarmusela3-89

gagtcggct

gaccccgtgaccgccactgttgaacactacggcggtgaaacacaggtccagaggcgccag

cacacagacgtctcgttcatattggacagatttgtgaaaataacaccaaaagaccaaatt

aacgtgttggacctgatgcaaacccctgcccacaccttggtgggcgcgctccttcgtact

gctacctactacttcgcggatttagaagtggcagtgaaacacgaggggaacctcacttgg

gtcccgaacggagcgcctgaggcagcgttggataacaccaccaacccaacagcttatcac

aaggcaccgctcacccgacttgcactgccttacacggcaccacaccgtgtgttggctact

gtttacaacggaaattgcaggtatggtgagagctctgtgactaatgtgaggggtgaccta

caagtgttggcccagaaggcggcgagaacgctgcctacctccttcaattacggtgctatc

aaggccactcgggtgactgaactgctttaccgcatgaagagggctgaaacatactgccca

cggcctctcttggccatccacccgaacgaagccagacacaaacaaaagattgtggcacct

gtgaaccactttctg

<Nablus-89

ccgggtgagtcggctgaccccg

tgaccgccactgttgaacactacggcggtgaaacacaggtccagaggcgccagcacacag

acgtctcgttcatattggacagatttgtgaaaataacaccaaaagaccaaattaacgtgt

tggacctgatgcaaacccctgcccacaccttggtgggcgcgctccttcgtactgctacct

actacttcgcggatttagaagtggcagtgaaacacgaggggaacctcacttgggtcccga

acggagcgcctgaggcagcgttggataacaccaccaacccaacagcttatcacaaggcac

cgctcacccgacttgcactgccttacacggcaccacaccgtgtgttggctactgtttaca

acggaaattgcaggtatggtgagagctctgtgactaatgtgaggggtgacctacaagtgt

tggcccagaaggcggcgagaacgctgcctacctccttcaattacggtgctatcaaggcca

ctcgggtgactgaactgctttaccgcatgaagagggctgaaacatactgcccacggcctc

tcttggccatccacccgaacgaagccagacacaaacaaaagattgtggcacctgtgaacc

actttctg

 

תמונה 11. רצף הבסיסים של הגן ל   VP1 של הבידודים השונים.

>Zarzir-04 4221

TTSAGESADPVTAHVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAX

>Kfar Manda-04

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Ber-Sheva-07 22032

TTSTGESADPVTTTVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESHTTNVRGDLQVLAQKAAITLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

<Eilot-07 22033

TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESHTTNVRGDLQVLAQKAAITLPTSFNYGAIKATRVTELLYRM

KRAXTYCPRPLLAIHPNEARHKQKIVAPVKQLL

<Bet-Sharim-07 22034

TTSTGESADPVTTTVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEIALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESHTTNVRGDLQVLAQKAAITLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

<Ramala-02 25034

TTSTGESADPVTATVENYGGETQVRRRRHTDVSFILDRFVKVTPKDQVNVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALENTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGEGAVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

<Ramala2-02 25035

TTSTGESADPVTATVENYGGETQVRRRRHTDVSFILDRFVKVTPKDQVNVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALENTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGEGAVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Tzofar-06

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Tzofar-06

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Ein Hashofet-04

TTSAGESADPVTAXVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESSVTNVRGDLQVLAQKTARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAX

>Zavidat-04 25038

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>El-Rom-04 25039

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETXCPRPLLAIHPSEARHKQKIVAX

>367597

TTSTGESADPVTTTVENYGGETQVRRRRHTDVSFILDRFVKVTPKDQVNVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALENTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGEGAVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Neve Ur-07

TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHKGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESHTTNARGDLQVLAQKAAITLPTSFNYGAIKATWVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Aborgieb-99

TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGEGPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKX

>Lehavot-Habashan-94 fmdv7

TTSAGESANPVIATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCRYGEGPVTAVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPDEARHKQKIVAPVKQLL

>South-Lebanon-94 fmdv8

TTSAGESANPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCRYGEGPVTAVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Sasa-94 fmdv9

TTSAGESANPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCRYGEGPVTAVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Jerico-94 fmdv10

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCRYGESSVTAVRGDLQVLARKAATTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Melea-94 fmdv11

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRAATYYFADLEVAVKHEGNLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYT

APHRVLATAYNGNCRYGESSVTAVRGDLQVLARKAATTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Taybee-94 fmdv12

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRATTYYFADLEVAVKHEGNLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCRYGESSVTAVRGDLQVLARKAATTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Gush-Halav-96 gus96Contig

TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDPITVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESSVTNVRGDLQVLVQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPGEARHKQKIVAPVTELL

>Jordan-99 2293-rev

TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGESPVTNVRGDLQVLAQKAAGTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Jorden-tafila-99

TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCKYGEGPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPSEARHKQKIVAPVKQLL

>Kalkilia-99

TTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHTLV

GALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLALPYTAP

HRVLATVYNGNCKYGEGPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRMKR

AETYCPRPLLAIHPSEARHKQKIVAX

>Kfarmusala1-89

TTSTGESADPVTATVEHYGGETQVQRRQHTDVSFILDRFVKITPKDQINVLDLMQTPAHT

LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYT

APHRVLATVYNGNCRYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRM

KRAETYCPRPLLAIHPNEARHKQKIVAPVKQLL

>Kfarmusela3-89

ESADPVTATVEHYGGETQVQRRQHTDVSFILDRFVKITPKDQINVLDLMQTPAHTLVGAL

LRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYTAPHRV

LATVYNGNCRYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRMKRAET

YCPRPLLAIHPNEARHKQKIVAPVNHFL

>Nablus-89

PGESADPVTATVEHYGGETQVQRRQHTDVSFILDRFVKITPKDQINVLDLMQTPAHTLVG

ALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYTAPH

RVLATVYNGNCRYGESSVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRMKRA

ETYCPRPLLAIHPNEARHKQKIVAPVNHFL

 

תמונה 12. רצף חומצות האמינו של הגנים שנבדקו.

 

 

לאחר ברור רצף הגנים נעשתה אנליזה של קירבה פילוגנטית על פי רצפי הבסיסים של הגנים כפי שמוצגת בתמונה 13.

 

תמונה 13. אנליזה של קירבה מולקולארית בין הבידודים השונים על פי רצף הבסיסים המלא של הגן ל VP1

 

 

כפי שניתן לראות, הבידודים שנבדקו מיצגים את הנגיפים שהיו אחראיים להתפרצויות מ 1989-עד 2007.

 הדבר הבולט שנראה מאנליזה זו הוא שלכל אחת מהתפרצויות היה אחראי נגיף חדש שחדר למדינה. המרחקים הגנטיים, כפי שמוצגים בתמונה, בין הנגיפים השונים הם גדולים כאלה, שהמסקנה היחידה היא שלכל אחת מההתפרצויות היה אחראי נגיף שונה שחדר למדינה או יותר נכון לאזור.

בכדי לאשש הנחה זו נעשתה בדיקה דומה והפעם עם רצף של ח. האמינו כפי שהתקבלו בתרגום ממוחשב של רצפי הבסיסים.

 

תמונה 14. אנליזה של קירבה מולקולארית בין הבידודים השונים על פי רצף החלבונים המלא של הגן ל VP1.

 

 

כפי שניתן לראות התמונה המתקבלת היא מאוד דומה אם לא זהה לאנליזה של רצף הבסיסים. דבר אחד בולט והוא ערכי ה bootstrap הנמוכים . דבר זה נובע מהשינויים הקטנים ברצף של החלבונים בין הבידודים השונים הגורם לאיכות סטטיסטית נמוכה יחסית.

מאחר והתוצאות מרמזות על כך שהתפרצויות השונות של המחלה נגרמות על ידי נגיף חדש החודר לאזור נעשה ניסיון לזהות עד כמה שניתן את מקור הנגיפים השונים. לבדיקה זו נבחרו הנגיפים מההתפרצויות של השנים 2007, 2004 ו 2007.

הרצפים של כל אחת מההתפרצויות נלקחו לאנליזת blast והרצפים של נגיפים שהראו את הקרבה ביותר נלקחו לאנליזה (טבלה 1).

 

טבלה 1. רצפים שנלקחו ממסדי נתונים לאנליזות.

 

באנליזה של הבידודים מ 2002 שהיו ברשות הפלסטינאית הוברר שישנה קירבה גדולה לנגיפים מחצי האי הערבי סעודיה, איחוד האמירויות ועומן שהופיעו ב 2001 שנה אחת לפני ההתפרצות ברשות.

 

תמונה 15. אנליזה של קירבה לזיהוי מקור הנגיף האחראי להתפרצות של 2002.

 

 

הנגיפים שנלקחו ממסד הנתונים ונבדקו באנליזה זו מופיעים בכתב נטוי מודגש עם קו תחתי באנליזה של ההתפרצות של 2004 נראית קירבה גבהה לבידודים מלבנון וטורקיה מ 2003 שנה לפני ההתפרצות במדינה וכן לבידודים מאיראן מ 2004 שניראה שהנגיף מלבנון וטורקיה עבר הן לארץ והן מזרחה לאיראן.

 

תמונה 16. אנליזה של קירבה לזיהוי מקור הנגיף האחראי להתפרצות של 2004. .

הנגיפים שנלקחו ממסד הנתונים ונבדקו באנליזה זו מופיעים בכתב נטוי מודגש עם קו תחתי

 

 

החיפוש והזיהוי המעניין ביותר הוא מציאת מקור הנגיף שהיה אחראי להתפרצות של 2007. כפי שנראה בתמונה 17 הזיהוי הולך 4 שנים מוקדם יותר ומיחס לנגיף שזוהה בנפאל ב 2003 משם הנגיף עבר לאפגניסטן ב 2004 משם לפקיסטן ב 2006 משם לירדן ב 2006 ובסופו של דבר למדינה ב 2007.

 

תמונה 17. אנליזה של קירבה לזיהוי מקור הנגיף האחראי להתפרצות של 2007. .

 

הנגיפים שנלקחו ממסד הנתונים ונבדקו באנליזה זו מופיעים בכתב נטוי מודגש עם קו תחתי

 

 

דיון

עבודה זו מתארת את בדיקות הרצף של הגן VP1 המלא של בידודים מייצגים את הנגיפים שהיו אחראיים להתפרצויות של מחלת הפה והטלפיים בין השנים 1989 ו 2007. לשם בדיקות הרצף הוחלט להגביר את הגן השלם כאשר תוצרי ההגברה ישמשו לבדיקות הרצף. הוכנו מספר תחיליים המתאימים לרצפים משני צידי הגן. בגלל השונות הגדולה ברצפים בין הנגיפים השונים נבחרו תחיליים המכונים לרצפים שמורים בין כל הנגיפים השייכים לטיפוס O. כל השילובים בין התחיליים השונים נבדקו ליעילות ההגברה כאשר נבדקה הריאקציה המאפשרת קבלת תוצר כזה המאפשר ניקוי ישירות של התוצרים ללא צורך בבידוד מגל אגרוז. ניקוי מג'ל הוא ארוך יותר ובעיקר אם אפשרות של קבלתו של DNA הכמות פחותה יותר. נבחרו התחיליים הטובים ביותר ונבדקה טמפרטורת ה annealing האופטימאלית כפי שנראה בתמונות 6-7. מאחר שכל DNA עבר בדיקת רצף עם מספר תחיליים היה צורך בכמות גדולה יחסית של DNA מכל אחת מהדוגמאות (תמונה 10A) המערכת שוכללה פעם נוספת ע"י שימוש בריאקצית nested PCR עם תחל פנימי שעדיין נמצא מעבר לגן הנבדק (תמונה 10). צורה זו אפשרה קבלת DNA באיכות וכמות גבוהה המתאימה לעבודה. על פי אנליזות (תמונות 13ו 14) הקרבה ניראה שכל אחת מהתפרצויות שהיו במדינה מקורם מכניסות מחודשות של נגיף חדש ולא מנגיף אנדמי הנמצא באזור. מסקנה זו נובעת מהעובדה שישנם מרחקים מולקולאריים גבוהים בין כל אחת מקבוצות הנגיפים האחראיים להתפרצויות המחלה. תמונות האנליזות המבוססות על רצפי הבסיסים והחלבונים מאוד קרובות אחת לשנייה אם לא זהות עובדה המחזקת את המסקנה הזו. מקרה מעניין היה ב 1994 בו שני נגיפים שונים היו אחראיים להתפרצויות. נגיף אחד היה אחראי להתפרצויות בגולן וצפון המדינה. נגיף שני היה אחראי להתפרצויות באזור המרכז. יש לציין, שתוצאות אנליזות הקרבה שנעשו על סמך הרצף המלא של הגן (על סמך עבודה זו) מאוד דומות לאלה שנעשו על סמך הרצף החלקי של הגן ל VP1. לחיזוק מסקנה זו, נעשה מאמץ לזהות את מקור הנגיפים נבדקו הנגיפים מהשנים 2002, 2004 ו 2007. בבדיקות blast נמצאו רצפים של נגיפים הקרובים לבידודים הישראליים, רצפים אילו צורפו לאנליזות קירבה עם הבידודים הישראליים. הבדיקות הללו מרמזים שמקור הנגיף של 2002 היו נגפים שבודדו ב 2001, שנה מוקדם להתפרצות ברשות הפלשתינאית ב 2002. כנראה שמקורו של הנגיף האחראי להתפרצות של 2004 הוא בנגיפים מ 2003 שניתן לזהותם בטורקיה ולבנון. בנוסף כנראה שההתפרצות באיראן ב 2004 מקורה באותם נגיפים שזוהו בלבנון וטורקיה. כך שהנגיף נדד למדינה ומזרחה לאיראן. התוצאה המסקרנת ביותר היא מוצא הנגיף של 2007. האנליזה מראה שהמסע החל בנפאל ב 2003 ארבע שנים לפני ההתפרצות במדינה, הנגיף הגיע לאפגניסטן ב 2004 משם לפקיסטן ולירדן ב 2006 ובסופו שהגיע למדינה ב 2007. 

 

Referernces

Brown, F., Newman, J., Stott, J., Porter, A., Frisby, D., Newton, C., Carey, N. and Fellner, P., 1974. Poly(C) in animal viral RNAs. Nature 251, 342-344.

Castro C, Arnold JJ, Cameron CE. Incorporation fidelity of the viral RNA-dependent RNA polymerase: a kinetic, thermodynamic and structural perspective. Virus Res. 2005 ;107 :141-149.

Devaney, M.A., Vakharia, V.N., Lloyd, R.E., Ehrenfeld, E. and Grubman, M.J., 1988. Leader protein of foot-and-mouth disease virus is required for cleavage of the p220 component of the cap-binding protein complex. J. Virol. 62, 4407-4409.

Domingo, E., Escarmis, C., Baronowski, E., Ruiz-Jarabo, C.M., Carrillo, E., Nf1;ez, J.I., Sobrino, F., 2003. Evolution of foot-and-mouth disease virus, Virus 91, 47-63.

Dowbenko, T. D.J., Yansura, D.G., Small, B. and Kleid, D.G., 1985. Nucleotide and amino acid sequence coding for polypeptides of foot-and-mouth disease virus type A12. J. Virol. 54, pp. 651-660.

Etchison, D., Milburn, S.C., Edery, I., Sonenberg, N. and Hershey, J.W., 1982. Inhibition of HeLa cell protein synthesis following poliovirus infection correlates with the proteolysis of a 220a0;000-Da polypeptide associated with eucaryotic initiation factor 3 and a cap binding protein complex. J. Biol. Chem. 257,. 14806-14810.

Forss, S. and Schaller, H., 1982. A tandem repeat gene in a picornavirus. Nucleic Acids Res. 10, 6441-6450.

Grubman, M.J., 1980. The 52032;-end of foot-and-mouth disease virion RNA contains a protein covalently linked to the nucleotide pUp. Arch. Virol. 63, 311-315.

Grubman, M.J., Robertson, B.H., Morgan, D.O., Moore, D.M. and Dowbenko, D., 1984. Biochemical map of polypeptides specified by foot-and-mouth disease virus. J. Virol. 50, 579-586.

Grubman MJ, Baxt B. Foot-and-mouth disease. Clin Microbiol Rev. 2004 17 :465-493.

Hargreaves SK, Foggin CM, Anderson EC, Bastos AD, Thomson GR, Ferris NP, Knowles NJ. An investigation into the source and spread of foot and mouth disease virus from a wildlife conservancy in Zimbabwe. Rev Sci Tech. 2004 23: 783-790.

Jackson, T., Stuart, D.I., Fry, E., 2003. Structure and receptor binding. Virus 91, 33-46.

Knowles NJ, Samuel AR, Davies PR, Midgley RJ, Valarcher JF. Pandemic strain of foot-and-mouth disease virus serotype O. Emerg Infect Dis. 2005 11: 1887-1893.

Knowles NJ, Samuel AR.Molecular epidemiology of foot-and-mouth disease virus. Virus Res. 2003 91: 65-80. Knowles, N.J., Samuel, A.R., 2003. Molecular epidemiology of foot-and-mouth disease virus. Virus 91, 65-80

. Medina, M.,

Domingo, E., Brangwyn, J.K. and Belsham, G.J., 1993. The two species of the foot-and-mouth disease virus leader protein, expressed individually, exhibit the same activities. Virology 194, 355-359.

Robertson, B.H., Grubman, M.J., Weddell, G.N., Moore, D.M., Welsh, J.D., Fischer, T., Dowbenko, D.J., Yansura, D.G., Small, B. and Kleid, D.G., 1985. Nucleotide and amino acid sequence coding for polypeptides of foot-and-mouth disease virus type A12. J. Virol. 54, 651-660.

Rodriguez A, Martinez-Salas E, Dopazo J, Davila M, Saiz JC, Sobrino F. Primer design for specific diagnosis by PCR of highly variable RNA viruses: typing of foot-and-mouth disease virus.Virology. 1992 189: 363-367.

Rueckert, R.R. and Wimmer, E., 1984. Systematic nomenclature of picornavirus proteins. J. Virol. 50, 957-959

Sangar, D.V., Rowlands, D.J., Harris, T.J. and Brown, F., 1977. Protein covalently linked to foot-and-mouth disease virus RNA. Nature 268, 648-650.

Stram Y, Chai D, Fawzy HE, Molad T, Meiri N, Van-Ham M, el-Kilani S, Fahamy F, Moussa AA, Yadin H.Molecular epidemiology of foot-and-mouth disease (FMD) in Israel in 1994 and in other Middle-Eastern countries in the years 1992-1994. Arch Virol. 1995; 140: 1791-1797.

Stram Y, Brenner J, Braverman Y, Banet-Noach C, Kuznetzova L, Ginni M. Akabane virus in Israel: a new virus lineage.Virus Res. 2004 104:93-97.

לכל המבזקים....
office@milk.org.il פקס: 972-3-9564766 טל: 972-3-9564750 דרך החורש 4 , ת"ד 97, יהוד 5647003
מופעל באמצעות מעוף - מגוון אפקט